General Information

  • ID:  hor006286
  • Uniprot ID:  Q64387
  • Protein name:  Neuropeptide 2
  • Gene name:  Pnoc
  • Organism:  Mus musculus (Mouse)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  In embryonic brain, first detected at day 14 and in postnatal brain, levels increase in day 1 and day 18. Levels decrease significantly in adults.|Brain and spinal cord. Low levels in kidney and spleen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0097060 synaptic membrane

Sequence Information

  • Sequence:  FSEFMRQYLVLSMQSSQ
  • Length:  17(160-176)
  • Propeptide:  MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
  • Signal peptide:  MKILFCDVLLLSLLSSVFS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. When administered intracerebroventricu
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oprl1
  • Target Unid:  P35377
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q64387-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006286_AF2.pdbhor006286_ESM.pdb

Physical Information

Mass: 236694 Formula: C92H141N23O28S2
Absent amino acids: ACDGHIKNPTW Common amino acids: S
pI: 6.4 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -10.59 Boman Index: -2755
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 62.94
Instability Index: 6727.06 Extinction Coefficient cystines: 1490
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  8645247
  • Title:  Structure and regional distribution of nociceptin/orphanin FQ precursor.
  • PubMed ID:  7503733
  • Title:  N23K, a gene transiently up-regulated during neural differentiation, encodes a precursor protein for a newly identified neuropeptide nociceptin.
  • PubMed ID:  8710928
  • Title:  Structure, tissue distribution, and
  • PubMed ID:  8663129
  • Title:  
  • PubMed ID:  8670093
  • Title:  
  • PubMed ID:  9601687
  • Title: